Home
Products
Primary Antibodies
UBC Polyclonal antibody, PBS Only (10457-1-PBS)

Filter: AllIHC

IHC staining of human lung cancer using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of human urothelial carcinoma using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of human urothelial carcinoma using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of mouse stomach using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of rat liver using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of rat pancreas using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of rat stomach using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.
IHC staining of rat stomach using 10457-1-AP (same clone as 10457-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10457-1-AP (UBC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10457-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

UBC Polyclonal antibody, PBS Only

Name: UBC Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10457-1-PBS

UBC Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 10457-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

10457-1-PBS targets UBC in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0711 Product name: Recombinant human UBC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-265 aa of BC008955 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE Predict reactive species
Full Name	ubiquitin C
Calculated Molecular Weight	60 kDa
GenBank Accession Number	BC008955
Gene Symbol	UBC
Gene ID (NCBI)	7316
RRID	AB_2241301
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P0CG48
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Ubiquitin (Ub) is a small, highly conserved eukaryotic protein that has an essential role in diverse cellular signaling pathways, including targeting proteins for proteasomal degradation. Cellular Ub is comprised of two distinct pools consisting of free Ub and Ub-substrate conjugates. UbC is a polyubiquitine gene that encodes Ub polyprotein. UbC, as stress-inducible polyubiquitin precursor proteins of around 9-11 monomers, is cleaved into monomeric ubiquitin by cellular deubiquitylating enzymes.