Tested Applications
| Positive WB detected in | HEK-293T cells, L02 cells, SMMC-7721 cells, HEK-293 cells, Ramos cells |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | mouse ovary tissue, human placenta tissue, rat lung tissue, rat colon tissue, human colon cancer tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | L02 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14520-1-AP targets UBC12 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5984 Product name: Recombinant human UBC12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-183 aa of BC058924 Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Predict reactive species |
| Full Name | ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast) |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC058924 |
| Gene Symbol | UBC12 |
| Gene ID (NCBI) | 9040 |
| RRID | AB_2878063 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61081 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for UBC12 antibody 14520-1-AP | Download protocol |
| IHC protocol for UBC12 antibody 14520-1-AP | Download protocol |
| IP protocol for UBC12 antibody 14520-1-AP | Download protocol |
| WB protocol for UBC12 antibody 14520-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-UBE2M (catalog #14520-1-AP) has 21 citations published in journals including Nature Communications, Advanced Science, Cell Death & Disease, Journal of Translational Medicine, iScience, eLife, Pharmacological Research, and Journal of Experimental & Clinical Cancer Research. Research fields span neddylation biology, oncology (breast, lung, melanoma, prostate, gastric, and ovarian cancers), inflammation, kidney injury, liver fibrosis, psoriasis, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Nat Commun A potent small-molecule inhibitor of the DCN1-UBC12 interaction that selectively blocks cullin 3 neddylation. | ||
J Exp Clin Cancer Res Neddylation activated TRIM25 desensitizes triple-negative breast cancer to paclitaxel via TFEB-mediated autophagy | ||
Adv Sci (Weinh) Neddylation Targets and Stabilizes NLRP3 to Augment Inflammasome-Mediated Colitis and Mood Disorder. | ||
Cancer Biol Med CUL4 E3 ligase regulates the proliferation and apoptosis of lung squamous cell carcinoma and small cell lung carcinoma. | ||
Cell Death Dis UBE2M-mediated neddylation modification stabilizes VEGFR2 to delay pulmonary vascular endothelial cell senescence.
| ||
Cell Death Dis PRMT1-mediated methylation of UBE2m promoting calcium oxalate crystal-induced kidney injury by inhibiting fatty acid metabolism. |
Reviews
What customers say
One reviewer tested this antibody as a free sample for Western Blot on EpH4 mammary gland cells at a 1:250–1:500 dilution, loading 40 µg of protein per well. She rated it 4 out of 5 stars, noting clean results with no non-specific bands. Her only suggestion was that she would have liked to be able to use a higher dilution of the antibody.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maria (Verified Customer) (02-06-2018) | I tested a free sample of this antibody.No non-specific bands.Load 40ug of protein for a well (15 well comb)I wish I could use a higher dilution of the antibody.
 |
