• Featured Product
  • KD/KO Validated

UBC12 Monoclonal antibody

UBC12 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67482-1-Ig
Clone No.1H8D2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

UBE2M, EC:2.3.2.34, hUbc12, NEDD8 carrier protein, NEDD8 conjugating enzyme Ubc12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, HeLa cells, HepG2 cells, L02 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67482-1-Ig targets UBC12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5984

Product name: Recombinant human UBC12 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-183 aa of BC058924

Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC058924
Gene Symbol UBC12
Gene ID (NCBI) 9040
RRIDAB_2882709
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61081
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for UBC12 antibody 67482-1-IgDownload protocol
IHC protocol for UBC12 antibody 67482-1-IgDownload protocol
WB protocol for UBC12 antibody 67482-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB

Cell Rep

Type I interferon/STAT1 signaling regulates UBE2M-mediated antiviral innate immunity in a negative feedback manner

Authors - Xianghui Kong
Loading...
||
New chat Able
正在加载,请稍候...