UBC12 Monoclonal antibody

• 

  WB analysis of HEK-293 using 67482-1-Ig

  WB result of UBC12 antibody (67482-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-UBC12 transfected HEK-293 cells.

• 

  WB analysis using 67482-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67482-1-Ig (UBC12 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67482-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67482-1-Ig (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67482-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67482-1-Ig (UBC12 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 67482-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using UBC12 antibody (67482-1-Ig, Clone: 1H8D2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

UBC12 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67482-1-Ig

Clone No.1H8D2

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UBE2M, EC:2.3.2.34, hUbc12, NEDD8 carrier protein, NEDD8 conjugating enzyme Ubc12

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells, HepG2 cells, L02 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67482-1-Ig targets UBC12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5984

  Product name: Recombinant human UBC12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-183 aa of BC058924

  Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

• Full Name: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC058924
• Gene Symbol: UBC12
• Gene ID (NCBI): 9040
• RRID: AB_2882709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P61081
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Rep; Type I interferon/STAT1 signaling regulates UBE2M-mediated antiviral innate immunity in a negative feedback manner; Authors - Xianghui Kong