UBC12 Monoclonal antibody, PBS Only

• 

  WB analysis using 67482-1-Ig (same clone as 67482-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67482-1-Ig (UBC12 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67482-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67482-1-Ig (same clone as 67482-1-PBS)

  WB result of UBC12 antibody (67482-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-UBC12 transfected HEK-293 cells. This data was developed using the same antibody clone with 67482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67482-1-Ig (same clone as 67482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67482-1-Ig (UBC12 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67482-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67482-1-Ig (same clone as 67482-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67482-1-Ig (UBC12 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67482-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67482-1-Ig (same clone as 67482-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using UBC12 antibody (67482-1-Ig, Clone: 1H8D2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67482-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UBC12 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67482-1-PBS

Clone No.1H8D2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

UBE2M, EC:2.3.2.34, hUbc12, NEDD8 carrier protein, NEDD8 conjugating enzyme Ubc12

---

Product Information

67482-1-PBS targets UBC12 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5984

  Product name: Recombinant human UBC12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-183 aa of BC058924

  Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

• Full Name: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC058924
• Gene Symbol: UBC12
• Gene ID (NCBI): 9040
• RRID: AB_2882709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P61081
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.