UBC12 Recombinant monoclonal antibody

• 

  WB analysis using 83628-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83628-1-RR (UBC12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HEK-293 using 83628-1-RR

  1x10^6 HEK-293 cells were intracellularly stained with 0.25 ug UBC12 Recombinant antibody (83628-1-RR, Clone:240477H5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• 

  Affinity and Kinetic Characterization of 83628-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83628-1-RR against Human UBC12 were performed. The affinity constant is 2.45 nM.

UBC12 Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83628-1-RR

Clone No.240477H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

UBE2M, NEDD8 protein ligase, NEDD8 conjugating enzyme Ubc12, NEDD8 carrier protein, hUbc12

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells, SMMC-7721 cells, A549 cells, HT-1080 cells
• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83628-1-RR targets UBC12 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5984

  Product name: Recombinant human UBC12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-183 aa of BC058924

  Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

• Full Name: ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC058924
• Gene Symbol: UBC12
• Gene ID (NCBI): 9040
• RRID: AB_3671241
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P61081
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBE2M (Ubiquitin-conjugating enzyme E2 M), also called UBC12, accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. The specific interaction between UBE2M and the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4. Involved in cell proliferation (PMID: 10207026; 15361859).