UBE2D1/2/3/4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBE2D1/2/3/4 Polyclonal antibody, PBS Only (28328-1-PBS)

• 

  WB analysis using 28328-1-AP (same clone as 28328-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28328-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 28328-1-AP (same clone as 28328-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 28328-1-AP (same clone as 28328-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 28328-1-AP (same clone as 28328-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 28328-1-AP (UBE2D2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28328-1-AP (same clone as 28328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 28328-1-AP (same clone as 28328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 28328-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28328-1-PBS in a different storage buffer formulation.

UBE2D1/2/3/4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28328-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28328-1-PBS targets UBE2D1/2/3/4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28736

  Product name: Recombinant human UBE2D2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC033349

  Sequence: MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTD

• Full Name: ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 14-17 kDa
• GenBank Accession Number: BC033349
• Gene Symbol: UBE2D2
• Gene ID (NCBI): 7322
• RRID: AB_2881114
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62837
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.