CoraLite® Plus 488-conjugated UBE2D1/2/3/4 Monoclonal antibody

UBE2D1/2/3/4 Monoclonal Antibody for IF/ICC
Cat No. CL488-68138
Clone No.1C7D12

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF/ICC

E2(17)KB3, UBC4/5, UBC5C, UBCH5C, UBE2D3, Ubiquitin carrier protein D3, Ubiquitin protein ligase D3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68138 targets UBE2D1/2/3/4 in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2278

Product name: Recombinant human UBE2D3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-147 aa of BC003395

Sequence: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
Calculated Molecular Weight 17 kDa
GenBank Accession NumberBC003395
Gene Symbol UBE2D3
Gene ID (NCBI) 7323
RRIDAB_3084414
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61077
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 UBE2D1/2/3/4 antibody CL488-68138Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...