UBE2D1/2/3/4 Polyclonal antibody

• 

  WB analysis using 15475-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15475-1-AP (UBE2D4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 15475-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15475-1-AP (UBE2D4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 15475-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 15475-1-AP (UBE2D4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 15475-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15475-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15475-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15475-1-AP (UBE2D1/2/3/4 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

UBE2D1/2/3/4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15475-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, CoIP, ELISA

Synonyms

HBUCE1, UBCH5D, UBE2D1, UBE2D1/2/3/4, UBE2D2, UBE2D3, UBE2D4, Ubiquitin carrier protein D4, Ubiquitin protein ligase D4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human testis tissue, rat brain tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• CoIP: See 1 publications below

Product Information

15475-1-AP targets UBE2D1/2/3/4 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7779

  Product name: Recombinant human UBE2D4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-147 aa of BC004104

  Sequence: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

• Full Name: ubiquitin-conjugating enzyme E2D 4 (putative)
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC004104
• Gene Symbol: UBE2D4
• Gene ID (NCBI): 51619
• RRID: AB_2210167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2X8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ubiquitination is a post-translational modification pathway or is part of the specific protein-degradation pathway by the 26S proteasome. Ubiquitination of a target protein involves multistep enzymatic reaction catalyzed by a cascade of enzymes including Ub-activating enzymes (E1s), Ub-conjugating enzymes (E2s) and Ub ligases (E3s) (PMID: 23542885). UBE2D family, which has 4 members named as UBE2D1/2/3/4, is an E2 ubiquitin-conjugating enzyme family in the ubiquitin-proteasome system. This antibody can recognize all the four members of UBE2D due to the high homology.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Infect Agent Cancer; Silencing of UBE2D1 inhibited cell migration in gastric cancer, decreasing ubiquitination of SMAD4.; Authors - Honghu Xie ; KD Validated
rat	WB	Environ Toxicol; Blood RNA-sequencing analysis in acrylamide-induced neurotoxicity and depressive symptoms in rats; Authors - Yng-Tay Chen
human,mouse	WB	Int Dent J; LncRNA AFAP1-AS1 Promotes Oral Squamous Cell Carcinoma Development by Ubiquitin-Mediated Proteolysis; Authors - Bao-Jun Li