UBE2H Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBE2H Polyclonal antibody, PBS Only (15685-1-PBS)

• 

  WB analysis using 15685-1-AP (same clone as 15685-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 15685-1-AP (same clone as 15685-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 15685-1-AP (same clone as 15685-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15685-1-AP (same clone as 15685-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15685-1-AP (same clone as 15685-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15685-1-AP (same clone as 15685-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 15685-1-AP (same clone as 15685-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 15685-1-AP (same clone as 15685-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15685-1-AP (UBE2H antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 15685-1-AP (same clone as 15685-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 15685-1-AP (UBE2H antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15685-1-PBS in a different storage buffer formulation.

UBE2H Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15685-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

UBC8, EC:2.3.2.24, EC:2.3.2.23, E2 ubiquitin-conjugating enzyme H, E2 20K

---

Product Information

15685-1-PBS targets UBE2H in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8187

  Product name: Recombinant human UBE2H protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-183 aa of BC006277

  Sequence: MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL

• Full Name: ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC006277
• Gene Symbol: UBE2H
• Gene ID (NCBI): 7328
• RRID: AB_10858632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62256
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.