UBE2O Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBE2O Polyclonal antibody (15812-1-AP)

• Featured Product
• KD/KO Validated

UBE2O Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15812-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

E2-230K, KIAA1734, UBE2O, Ubiquitin carrier protein O, Ubiquitin protein ligase O

• 

  WB analysis of HeLa using 15812-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15812-1-AP (UBE2O antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 15812-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 15812-1-AP (UBE2O antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 15812-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15812-1-AP (UBE2O antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 15812-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15812-1-AP (UBE2O Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 15812-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15812-1-AP (UBE2O Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UBE2O in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, Jurkat cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15812-1-AP targets UBE2O in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8580

  Product name: Recombinant human UBE2O protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC007822

  Sequence: SSDSGPEAGSQRLLFSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRL

• Full Name: ubiquitin-conjugating enzyme E2O
• Calculated Molecular Weight: 1292 aa, 141 kDa
• Observed Molecular Weight: 150 kDa, 200-230 kDa
• GenBank Accession Number: BC007822
• Gene Symbol: UBE2O
• Gene ID (NCBI): 63893
• RRID: AB_2211192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0C9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBE2O, also named as KIAA1734, belongs to the ubiquitin-conjugating enzyme family. It catalyzes the covalent attachment of ubiquitin to other proteins. UBE2O has a calculated molecular mass of 141 kDa, and many bands can be detected as 140-170 kDa and 200-230 kDa (PMID: 28774900, 23455153, 28774922, 11311559).

Publications

What published studies show

The antibody targeting UBE2O (Cat# 15812-1-AP) has a total of 5 citations. These appear in Advanced Science, Cell Death & Disease, Frontiers in Cell and Developmental Biology, International Journal of Medical Sciences, and Current Medical Science. The research fields span colorectal cancer malignant progression, breast cancer proliferation/EMT/stemness, and hepatocellular carcinoma proliferation/invasion/prognosis, with focus on the UBE2O/AMPKα2/mTORC1 signaling axis.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); Microprotein MP104 Promotes Malignant Progression of Colorectal Cancer Through Regulating Protein Translation.; Authors - Fang Chen
human	WB,IHC,IF	Cell Death Dis; UBE2O promotes the proliferation, EMT and stemness properties of breast cancer cells through the UBE2O/AMPKα2/mTORC1-MYC positive feedback loop.; Authors - Xu Liu ; KD Validated
human	IHC	Front Cell Dev Biol; Long Noncoding RNA HCG18 Promotes Malignant Phenotypes of Breast Cancer Cells via the HCG18/miR-103a-3p/UBE2O/mTORC1/HIF-1α-Positive Feedback Loop.; Authors - Xu Liu
human	IHC,WB	Int J Med Sci; UBE2O promotes hepatocellular carcinoma cell proliferation and invasion by regulating the AMPKα2/mTOR pathway; Authors - Zhan Shi ; KD Validated
human	IHC,WB	Curr Med Sci; High Level of Ubiquitin Conjugate Enzyme E2O Indicates Poor Prognosis of Patients with Hepatocellular Carcinoma; Authors - Si-Yu Lan