UBE2O Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBE2O Polyclonal antibody, PBS Only (15812-1-PBS)

• 

  WB analysis of HeLa using 15812-1-AP (same clone as 15812-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15812-1-AP (UBE2O antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15812-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 15812-1-AP (same clone as 15812-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 15812-1-AP (UBE2O antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15812-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 15812-1-AP (same clone as 15812-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15812-1-AP (UBE2O antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15812-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15812-1-AP (same clone as 15812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15812-1-AP (UBE2O Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15812-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 15812-1-AP (same clone as 15812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15812-1-AP (UBE2O Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15812-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UBE2O Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15812-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15812-1-PBS targets UBE2O in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8580

  Product name: Recombinant human UBE2O protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC007822

  Sequence: SSDSGPEAGSQRLLFSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRL

• Full Name: ubiquitin-conjugating enzyme E2O
• Calculated Molecular Weight: 1292 aa, 141 kDa
• Observed Molecular Weight: 150 kDa, 200-230 kDa
• GenBank Accession Number: BC007822
• Gene Symbol: UBE2O
• Gene ID (NCBI): 63893
• RRID: AB_2211192
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C0C9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UBE2O, also named as KIAA1734, belongs to the ubiquitin-conjugating enzyme family. It catalyzes the covalent attachment of ubiquitin to other proteins. UBE2O has a calculated molecular mass of 141 kDa, and many bands can be detected as 140-170 kDa and 200-230 kDa (PMID: 28774900, 23455153, 28774922, 11311559).