UBE2R2 Polyclonal antibody

• 

  WB analysis of Jurkat using 14077-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14077-1-AP (UBE2R2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 14077-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14077-1-AP (UBE2R2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14077-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14077-1-AP (UBE2R2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human spleen using 14077-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 14077-1-AP (UBE2R2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human spleen using 14077-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 14077-1-AP (UBE2R2 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HeLa using 14077-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 14077-1-AP (UBE2R2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

UBE2R2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14077-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Ubiquitin protein ligase R2, Ubiquitin carrier protein R2, UBC3B, EC:2.3.2.23, E2 ubiquitin-conjugating enzyme R2

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, mouse spleen tissue
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

14077-1-AP targets UBE2R2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5202

  Product name: Recombinant human UBE2R2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-238 aa of BC047584

  Sequence: MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

• Full Name: ubiquitin-conjugating enzyme E2R 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC047584
• Gene Symbol: UBE2R2
• Gene ID (NCBI): 54926
• RRID: AB_2878010
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q712K3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO J; Shared and distinct mechanisms of UBA1 inactivation across different diseases; Authors - Jason C Collins
human	WB	bioRxiv; Shared and Distinct Mechanisms of UBA1 Inactivation Across Different Diseases; Authors - Jason C Collins
mouse	WB	JCI Insight; PMID: 31292296; Authors - Isabelle K Vila
	WB	Nat Commun; BiDAC-dependent degradation of plasma membrane proteins by the endolysosomal system; Authors - Sammy Villa
human	WB	Exp Gerontol; p53 accelerates endothelial cell senescence in diabetic retinopathy by enhancing FoxO3a ubiquitylation and degradation via UBE2L6; Authors - Ying Cheng