UBE2R2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBE2R2 Polyclonal antibody (14077-1-AP)

UBE2R2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14077-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CDC34B, E2 ubiquitin-conjugating enzyme R2, EC:2.3.2.23, UBC3B, Ubiquitin carrier protein R2

• 

  WB analysis of Jurkat using 14077-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14077-1-AP (UBE2R2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse spleen using 14077-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 14077-1-AP (UBE2R2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14077-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14077-1-AP (UBE2R2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 14077-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 14077-1-AP (UBE2R2 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 14077-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 14077-1-AP (UBE2R2 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skeletal muscle using 14077-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 14077-1-AP (UBE2R2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14077-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HeLa cells using 14077-1-AP (UBE2R2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UBE2R2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, mouse spleen tissue
• Positive IHC detected in: human spleen tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14077-1-AP targets UBE2R2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5202

  Product name: Recombinant human UBE2R2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-238 aa of BC047584

  Sequence: MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

• Full Name: ubiquitin-conjugating enzyme E2R 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC047584
• Gene Symbol: UBE2R2
• Gene ID (NCBI): 54926
• RRID: AB_2878010
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q712K3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The UBE2R2 Polyclonal antibody (Cat# 14077-1-AP) has 5 total citations published in Nature Communications, EMBO Journal, JCI Insight, Experimental Gerontology, and bioRxiv. All citations used the antibody for Western blot. Research fields span endolysosomal protein degradation, UBA1 inactivation mechanisms across diseases, insulin resistance and metabolic syndrome in obesity, endothelial cell senescence in diabetic retinopathy, and ubiquitin-mediated protein regulation.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; BiDAC-dependent degradation of plasma membrane proteins by the endolysosomal system; Authors - Sammy Villa
human	WB	EMBO J; Shared and distinct mechanisms of UBA1 inactivation across different diseases; Authors - Jason C Collins
mouse	WB	JCI Insight; PMID: 31292296; Authors - Isabelle K Vila
human	WB	Exp Gerontol; p53 accelerates endothelial cell senescence in diabetic retinopathy by enhancing FoxO3a ubiquitylation and degradation via UBE2L6; Authors - Ying Cheng
human	WB	bioRxiv; Shared and Distinct Mechanisms of UBA1 Inactivation Across Different Diseases; Authors - Jason C Collins