UBE2S Polyclonal antibody

• 

  WB analysis of HL-60 using 18219-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 18219-1-AP (UBE2S antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 18219-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18219-1-AP (UBE2S antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDA-MB-453s using 18219-1-AP

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 18219-1-AP (UBE2S antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 18219-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 18219-1-AP (UBE2S antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 18219-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 18219-1-AP (UBE2S antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 18219-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18219-1-AP (UBE2S antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin cancer using 18219-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 18219-1-AP (UBE2S antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

UBE2S Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18219-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

OK/SW-cl.73, EPF5, EC:2.3.2.23, E2-EPF, E2EPF

---

Tested Applications

• Positive WB detected in: HL-60 cells, COLO 320 cells, MCF-7 cells, MDA-MB-453s cells, mouse ovary tissue
• Positive IHC detected in: human skin cancer tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18219-1-AP targets UBE2S in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12978

  Product name: Recombinant human UBE2S protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-222 aa of BC004236

  Sequence: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

• Full Name: ubiquitin-conjugating enzyme E2S
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC004236
• Gene Symbol: UBE2S
• Gene ID (NCBI): 27338
• RRID: AB_10598771
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16763
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBE2S(Ubiquitin-conjugating enzyme E2 S) is also named as E2EPF and belongs to the ubiquitin-conjugating enzyme family. It acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C) and a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Overexpression of UBE2S can increase tumor cell proliferation, invasion, and metastasis through the VHL-HIF pathway (PMID:16819549).