UBE2T/HSPC150 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86278-1-RR (same clone as 86278-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86278-1-RR (UBE2T antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 86278-1-RR (same clone as 86278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 86278-1-RR (UBE2T/HSPC150 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 86278-1-RR (same clone as 86278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 86278-1-RR (UBE2T/HSPC150 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86278-1-PBS in a different storage buffer formulation.

• 

  Affinity of 86278-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86278-1-RR against Human UBE2T/HSPC150 were performed. The affinity constant is 62.8 nM.

UBE2T/HSPC150 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 86278-1-PBS

Clone No.250784D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

HSPC150, UBE2T, Cell proliferation-inducing gene 50 protein, E2 ubiquitin-conjugating enzyme T, EC:2.3.2.23

---

Product Information

86278-1-PBS targets UBE2T/HSPC150 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0153

  Product name: Recombinant human UBE2T protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-190 aa of BC004152

  Sequence: QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIE

• Full Name: ubiquitin-conjugating enzyme E2T (putative)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC004152
• Gene Symbol: UBE2T
• Gene ID (NCBI): 29089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPD8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

uitin (Ub)-mediated protein degradation pathway involves three sequential enzymatic steps that facilitate the conjugation of Ub to specific protein substrates. The first step requires ATP-dependent activation of the C-terminus of Ub and the assembly of multi-Ubs by Ub-activating enzyme E1. The ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain, is then conjugated to Ubs, through a thiol-ester linkage between a conserved cysteine and the C-terminus of Ub, to generate an intermediate Ub-E2 complex. Then the E3, a ligase, catalyzes the transfer of Ub from E2 to the appropriate substrate. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins), which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways.