Tested Applications
| Positive WB detected in | BxPC-3 cells, HeLa cells, mouse brain tissue, mouse kidney tissue, rat brain tissue, rat kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10207-2-AP targets UBE2V1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0278 Product name: Recombinant human UBE2V1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 17-109 aa of BC000468 Sequence: LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLA Predict reactive species |
| Full Name | ubiquitin-conjugating enzyme E2 variant 1 |
| Calculated Molecular Weight | 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC000468 |
| Gene Symbol | UBE2V1 |
| Gene ID (NCBI) | 7335 |
| RRID | AB_2272560 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13404 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UBE2V1(Ubiquitin-conjugating enzyme E2 variant 1) is also named as CROC1, UBE2V, UEV1 and belongs to the ubiquitin-conjugating enzyme family. It has no ubiquitin ligase activity on its own and the UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. CROC1 transcripts in all human tissues examined, with highest levels in brain, skeletal muscle, and kidney(PMID:9305758). It has 5 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for UBE2V1 antibody 10207-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The UBE2V1 Polyclonal antibody (catalog number 10207-2-AP) has 1 total citation. It appears in the journal Journal of Advanced Research. The associated research field involves m6A modification mediating mitochondrial homeostasis imbalance and apoptosis in mouse spermatocytes, focusing on mitophagy versus mitochondrial damage induced by Benzo[b]fluoranthene, using Western blot.
| Species | Application | Title |
|---|---|---|
J Adv Res The m(6)A modification mediates the imbalance of mitochondrial homeostasis and apoptosis induced by Benzo[b]fluoranthene in mouse spermatocytes: mitophagy versus mitochondrial damage. |
Reviews
What customers say
The single review for this product reports a Western Blot on HEK293T cells at a 1:200 dilution. The user rated it 3 out of 5, noting that the antibody signal was quite weak and that some off-target products were observed. The protocol used 5% BSA in milk with an overnight incubation at 4°C. Overall, the feedback suggests the antibody may require optimization for stronger, more specific signal in this cell line.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sarah (Verified Customer) (09-05-2025) | Antibody signal was quite weak in HEK293T cells, including some off-target products as well. Antibody was used in 5% BSA in milk with overnight incubation at 4C.
|
