UBE2V2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP02524-1

  The mean MMS2 concentration was determined to be 98.67 ng/mL in HEK-293 cell extract based on a 1.20 mg/mL extract load, 19.79 ng/mL in A375 cell extract based on a 1.60 mg/mL extract load and 14.71 ng/mL in K-562 cell extract based on a 1.20 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02524-1

  Sandwich ELISA standard curve of MP02524-1, Human MMS2 Recombinant Matched Antibody Pair - PBS only. 86551-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1111. 86551-1-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

• 

  Cytometric bead array sample test of MP02524-1

  The mean MMS2 concentration was determined to be 20.3 ng/mL in HEK-293 cell extract based on a 1.1 mg/mL extract load, 18.8 ng/mL in A375 cell extract based on a 1.6 mg/mL extract load, 31.7 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02524-1

  Cytometric bead array standard curve of MP02524-1, MMS2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86551-2-PBS. Detection antibody: 86551-1-PBS. Standard: Ag1111. Range: 6.25-200 ng/mL.

• 

  Affinity of 86551-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 86551-2-PBS against Human UBE2V2 was performed. The affinity constant is 4.93 nM.

UBE2V2 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86551-2-PBS

Clone No.251485H1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

MMS2, DDVit 1, DDVIT1, EDAF 1, EDAF-1

---

Product Information

86551-2-PBS targets UBE2V2 as part of a matched antibody pair:

MP02524-1: 86551-2-PBS capture and 86551-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1111

  Product name: Recombinant human UBE2V2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-145 aa of BC007051

  Sequence: MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Full Name: ubiquitin-conjugating enzyme E2 variant 2
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC007051
• Gene Symbol: MMS2
• Gene ID (NCBI): 7336
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15819
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.