UBR1 Polyclonal antibody

• 

  WB analysis using 26069-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26069-1-AP (UBR1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 26069-1-AP

  IP result of anti-UBR1 (IP:26069-1-AP, 4ug; Detection:26069-1-AP 1:300) with mouse skeletal muscle tissue lysate 4000ug.

UBR1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26069-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, CoIP, ELISA

Synonyms

E3 ubiquitin-protein ligase UBR1, EC:2.3.2.27, JBS, N recognin 1, N-recognin-1

---

Tested Applications

• Positive WB detected in: BGC-823 cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IP detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

26069-1-AP targets UBR1 in WB, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22076

  Product name: Recombinant human UBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC113505

  Sequence: MADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQL

• Full Name: ubiquitin protein ligase E3 component n-recognin 1
• Calculated Molecular Weight: 1749 aa, 200 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC113505
• Gene Symbol: UBR1
• Gene ID (NCBI): 197131
• RRID: AB_2880360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWV7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB,IP	J Cachexia Sarcopenia Muscle; Identification of Ubr1 as an amino acid sensor of steatosis in liver and muscle; Authors - Wanni Zhao
human	WB,CoIP	EMBO Rep; METTL3 protects METTL14 from STUB1-mediated degradation to maintain m6 A homeostasis; Authors - Zhan-Cheng Zeng
human	WB	Aging (Albany NY); UBR1 is a prognostic biomarker and therapeutic target associated with immune cell infiltration in gastric cancer; Authors - Weiwei Yuan
	WB	Mol Cell; A regulator of amino acid sensing links lipid peroxidation and lipid droplet-dependent antioxidant response; Authors - Jinhua Li
human	WB	Diabetes; N-end Rule-Mediated Proteasomal Degradation of ATGL Promotes Lipid Storage; Authors - Jiesi Xu ; KD Validated