UBR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UBR1 Polyclonal antibody, PBS Only (26069-1-PBS)

• 

  WB analysis using 26069-1-AP (same clone as 26069-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26069-1-AP (UBR1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26069-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 26069-1-AP (same clone as 26069-1-PBS)

  IP result of anti-UBR1 (IP:26069-1-AP, 4ug; Detection:26069-1-AP 1:300) with mouse skeletal muscle tissue lysate 4000ug. This data was developed using the same antibody clone with 26069-1-PBS in a different storage buffer formulation.

UBR1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 26069-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

E3 ubiquitin-protein ligase UBR1, EC:2.3.2.27, JBS, N recognin 1, N-recognin-1

---

Product Information

26069-1-PBS targets UBR1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22076

  Product name: Recombinant human UBR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC113505

  Sequence: MADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQL

• Full Name: ubiquitin protein ligase E3 component n-recognin 1
• Calculated Molecular Weight: 1749 aa, 200 kDa
• Observed Molecular Weight: 200 kDa
• GenBank Accession Number: BC113505
• Gene Symbol: UBR1
• Gene ID (NCBI): 197131
• RRID: AB_2880360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IWV7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.