CoraLite® Plus 488-conjugated UGDH Monoclonal antibody

• 

  IF Staining of HeLa using CL488-67360

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 UGDH antibody (CL488-67360, Clone: 1E2E1 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

UGDH Monoclonal Antibody for IF/ICC

Cat No. CL488-67360

Clone No.1E2E1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, pig

Applications

IF/ICC

Synonyms

GDH, UDP Glc dehydrogenase, UDP GlcDH, UDP glucose 6 dehydrogenase, UDP glucose dehydrogenase, UDPGDH, UGD, UGDH

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67360 targets UGDH in IF/ICC applications and shows reactivity with Human, Mouse, Rat, pig samples.

• Tested Reactivity: Human, Mouse, Rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29747

  Product name: Recombinant human UGDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-301 aa of BC022781

  Sequence: MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ

• Full Name: UDP-glucose dehydrogenase
• Calculated Molecular Weight: 494 aa, 55 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC022781
• Gene Symbol: UGDH
• Gene ID (NCBI): 7358
• RRID: AB_3084339
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O60701
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

UDP-glucose 6-dehydrogenase (UGDH) is a key enzyme in the uronic acid pathway, and converts UDP-glucose (UDP-Glc) to UDP-glucuronic acid (UDP-GlcA). UGDH is critical to the production of extracellular matrix components which are essential to the migration and connectivity of neurons early in human brain development. UDP-GlcA is an essential sugar nucleotide precursor and a key component in the synthesis and stepwise degradation of glycosaminoglycans (GAGs). The protein subunit migrates on SDS-PAGE at ~55 kDa. (PMID: 32175296, PMID: 21576248, PMID: 31243371).