• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated UGDH Monoclonal antibody

UGDH Monoclonal Antibody for IF/ICC
Cat No. CL488-67360
Clone No.1E2E1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, pig

Applications

IF/ICC

GDH, UDP Glc dehydrogenase, UDP GlcDH, UDP glucose 6 dehydrogenase, UDP glucose dehydrogenase, UDPGDH, UGD, UGDH

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67360 targets UGDH in IF/ICC applications and shows reactivity with Human, Mouse, Rat, pig samples.

Tested Reactivity Human, Mouse, Rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29747

Product name: Recombinant human UGDH protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-301 aa of BC022781

Sequence: MFEIKKICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNESRINAWNSPTLPIYEPGLKEVVESCRGKNLFFSTNIDDAIKEADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQ

Predict reactive species
Full Name UDP-glucose dehydrogenase
Calculated Molecular Weight 494 aa, 55 kDa
Observed Molecular Weight 55-60 kDa
GenBank Accession NumberBC022781
Gene Symbol UGDH
Gene ID (NCBI) 7358
RRIDAB_3084339
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO60701
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

UDP-glucose 6-dehydrogenase (UGDH) is a key enzyme in the uronic acid pathway, and converts UDP-glucose (UDP-Glc) to UDP-glucuronic acid (UDP-GlcA). UGDH is critical to the production of extracellular matrix components which are essential to the migration and connectivity of neurons early in human brain development. UDP-GlcA is an essential sugar nucleotide precursor and a key component in the synthesis and stepwise degradation of glycosaminoglycans (GAGs). The protein subunit migrates on SDS-PAGE at ~55 kDa. (PMID: 32175296, PMID: 21576248, PMID: 31243371).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 UGDH antibody CL488-67360Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...