UGT2A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UGT2A1 Polyclonal antibody, PBS Only (24343-1-PBS)

• 

  WB analysis using 24343-1-AP (same clone as 24343-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24343-1-AP (UGT2A1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24343-1-PBS in a different storage buffer formulation.

UGT2A1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24343-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24343-1-PBS targets UGT2A1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19421

  Product name: Recombinant human UGT2A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-124 aa of BC157012

  Sequence: PMEGSHWLNVKIIIDELIKKEHNVTVLVASGALFITPTSNPSLTFEIYRVPFGKERIEGVIKDFVLTWLENRPSPSTIWRFYQEMAKVIKDFHMVSQE

• Full Name: UDP glucuronosyltransferase 2 family, polypeptide A1
• Calculated Molecular Weight: 527 aa, 60 kDa
• Observed Molecular Weight: 50-53 kDa
• GenBank Accession Number: BC157012
• Gene Symbol: UGT2A1
• Gene ID (NCBI): 10941
• RRID: AB_2879502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DTE4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.