Filter: AllWBIHC

WB analysis using 21366-1-AP (same clone as 21366-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 21366-1-AP (UGT3A2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21366-1-PBS in a different storage buffer formulation.
WB analysis of human testis using 21366-1-AP (same clone as 21366-1-PBS)
human testis tissue were subjected to SDS PAGE followed by western blot with 21366-1-AP (UGT3A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21366-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 21366-1-AP (same clone as 21366-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21366-1-AP (UGT3A2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21366-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 21366-1-AP (same clone as 21366-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21366-1-AP (UGT3A2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21366-1-PBS in a different storage buffer formulation.

UGT3A2 Polyclonal antibody, PBS Only

Name: UGT3A2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21366-1-PBS

UGT3A2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21366-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

21366-1-PBS targets UGT3A2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15835 Product name: Recombinant human UGT3A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 75-129 aa of BC103925 Sequence: QVISWLAPEDHQREFKKSFDFFLEETLGGRGKFENLLNVLEYLALQCSHFLNRKD Predict reactive species
Full Name	UDP glycosyltransferase 3 family, polypeptide A2
Calculated Molecular Weight	523 aa, 60 kDa
Observed Molecular Weight	50-55 kDa
GenBank Accession Number	BC103925
Gene Symbol	UGT3A2
Gene ID (NCBI)	167127
RRID	AB_10888629
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q3SY77
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.