UGT8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UGT8 Polyclonal antibody, PBS Only (17982-1-PBS)

• 

  WB analysis of rat brain using 17982-1-AP (same clone as 17982-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 17982-1-AP (UGT8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 17982-1-AP (same clone as 17982-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 17982-1-AP (UGT8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 17982-1-AP (same clone as 17982-1-PBS)

  IP result of anti-UGT8 (IP:17982-1-AP, 4ug; Detection:17982-1-AP 1:1000) with rat brain tissue lysate 4000ug. This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17982-1-AP (same clone as 17982-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17982-1-AP (UGT8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 17982-1-AP (same clone as 17982-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 17982-1-AP (UGT8 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 17982-1-AP (same clone as 17982-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17982-1-AP (UGT8 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 17982-1-AP (same clone as 17982-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17982-1-AP (UGT8 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17982-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UGT8 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17982-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

UGT 8, UDP-galactose-ceramide galactosyltransferase, EC:2.4.1.47, CGT, Ceramide UDP-galactosyltransferase

---

Product Information

17982-1-PBS targets UGT8 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12393

  Product name: Recombinant human UGT8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 38-402 aa of BC075069

  Sequence: FKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPAPLAYVPEFNSLLTDRMNLLQRMKNTGVYLISRLGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGALGRLPQKVIWRFSGPKPKNLGNNTKLIEWLPQNDLLGHSKIKAFLSHGGLNSIFETMYHGVPVVGIPLFGDHYDTMTRVQAKGMGILLEWK

• Full Name: UDP glycosyltransferase 8
• Calculated Molecular Weight: 541 aa, 61 kDa
• Observed Molecular Weight: 61 kDa
• GenBank Accession Number: BC075069
• Gene Symbol: UGT8
• Gene ID (NCBI): 7368
• RRID: AB_2214254
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16880
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UGT8, also known as galacotosylceramide synthase or CGT (ceramide galactosyltransferase), is a key enzyme for galacotosylceramide (GalCer) biosynthesis. It is an ER transmembrane protein and has limited tissue distribution, with predominance in Schwann cells, oligodendrocytes, kidneys, testes, and intestine. UGT8 is highly enriched in myelin in the central nervous system. Its expression levels are strongly associated with histological typing in human oligodendrogliomas and astrocytomas; can be used as molecular marker to distinguish these tumors. Higher UGT8 levels had also been linked to metastatic properties of cancer cells. This antibody specifically recognizes the endogenous UGT8.