UHRF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UHRF1 Polyclonal antibody, PBS Only (21402-1-PBS)

• 

  WB analysis using 21402-1-AP (same clone as 21402-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21402-1-AP (UHRF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21402-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 21402-1-AP (same clone as 21402-1-PBS)

  WB result of UHRF1 antibody (21402-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-UHRF1 transfected HEK-293T cells. This data was developed using the same antibody clone with 21402-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21402-1-AP (same clone as 21402-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21402-1-AP (UHRF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21402-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 21402-1-AP (same clone as 21402-1-PBS)

  IP result of anti-UHRF1 (IP:21402-1-AP, 4ug; Detection:21402-1-AP 1:1000) with HeLa cells lysate 3200ug. This data was developed using the same antibody clone with 21402-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21402-1-AP (same clone as 21402-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using UHRF1 antibody (21402-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21402-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

UHRF1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 21402-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

ICBP90, HuNp95, hUHRF1, hNp95, EC:2.3.2.27

---

Product Information

21402-1-PBS targets UHRF1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16111

  Product name: Recombinant human UHRF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 88-392 aa of BC113875

  Sequence: QSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRE

• Full Name: ubiquitin-like with PHD and ring finger domains 1
• Calculated Molecular Weight: 806 aa, 91 kDa
• Observed Molecular Weight: 91-100 kDa
• GenBank Accession Number: BC113875
• Gene Symbol: UHRF1
• Gene ID (NCBI): 29128
• RRID: AB_10860902
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96T88
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2. In addition, UHRF1 is a novel metabolic guardian restricting AMPK activity(PMID: 34907338).