CoraLite® Plus 488-conjugated UHRF1 Recombinant monoclonal antibody

UHRF1 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84489-5
Clone No.241872G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

241872G4, E3 ubiquitin-protein ligase UHRF1, EC:2.3.2.27, hNp95, hUHRF1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84489-5 targets UHRF1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17498

Product name: Recombinant human UHRF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 88-392 aa of BC113875

Sequence: QSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRE

Predict reactive species
Full Name ubiquitin-like with PHD and ring finger domains 1
Calculated Molecular Weight 806 aa, 91 kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberBC113875
Gene Symbol UHRF1
Gene ID (NCBI) 29128
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96T88
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2. In addition, UHRF1 is a novel metabolic guardian restricting AMPK activity(PMID: 34907338).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 UHRF1 antibody CL488-84489-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...