ULBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ULBP1 Polyclonal antibody, PBS Only (17715-1-PBS)

• 

  WB analysis of HEK-293 using 17715-1-AP (same clone as 17715-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17715-1-AP (ULBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17715-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 17715-1-AP (same clone as 17715-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17715-1-AP (ULBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17715-1-PBS in a different storage buffer formulation.

ULBP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17715-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17715-1-PBS targets ULBP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12079

  Product name: Recombinant human ULBP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-244 aa of BC035416

  Sequence: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR

• Full Name: UL16 binding protein 1
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC035416
• Gene Symbol: ULBP1
• Gene ID (NCBI): 80329
• RRID: AB_2214685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.