ULBP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ULBP3 Polyclonal antibody, PBS Only (30058-1-PBS)

• 

  WB analysis using 30058-1-AP (same clone as 30058-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30058-1-AP (ULBP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30058-1-PBS in a different storage buffer formulation.

ULBP3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30058-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30058-1-PBS targets ULBP3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32424

  Product name: Recombinant human ULBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-150 aa of

  Sequence: DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFL

• Full Name: UL16 binding protein 3
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• Gene Symbol: ULBP3
• Gene ID (NCBI): 79465
• RRID: AB_3086222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ULBP3 (UL16 binding protein-3), a class 1 major histocompatibility complex-like (MHC-like) molecule and member of the family of ligands of the killer cell lectin-like receptor subfamily K member 1 (NKG2D) (PMID:31292299). ULBP3 are expressed at the cell surface of multiple types of cells and tissues as a glycosylphosphatidylinositol (GPI)-linked proteins (PMID:22741585).