UMODL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UMODL1 Polyclonal antibody (31666-1-AP)

• 

  WB analysis using 31666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31666-1-AP (UMODL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31666-1-AP (UMODL1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

UMODL1 Polyclonal Antibody for WB, ELISA

Cat No. 31666-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Olfactorin, uromodulin like 1

---

Tested Applications

• Positive WB detected in: Saos-2 cells, mouse testis tissue, TT cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31666-1-AP targets UMODL1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36223

  Product name: Recombinant human UMODL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-650 aa of BC167790

  Sequence: RQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTRDATPSRAGRACEGDLVSPMGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPAAGQAWTPEPSPRRGGSNVVGYDRNNTGKGVEQELQGNSIMEPPSWPSPTE

• Full Name: uromodulin-like 1
• Observed Molecular Weight: 136-157 kDa
• GenBank Accession Number: BC167790
• Gene Symbol: UMODL1
• Gene ID (NCBI): 89766
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5DID0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UMODL1(Uromodulin-like 1, uromodulin-like protein 1) is an important functional glycoprotein, belonging to the uromodulin (UMOD) gene family. Members of this family are usually expressed in kidney and urinary system, and play a role in the structure and function of extracellular matrix. Protein is located in extracellular matrix, and some studies have pointed out that UMODL1 can be used as one of the predictive markers of diabetes in multi-omics. It is involved in the process of fat development and the cell response to gonadotropin-releasing hormone (GnRH). It may also play a role in the development of ovarian follicles and participate in the migration of neutrophils. There are many isoforms, and the predicted molecular weight is 136-157 kDa.