Use Able AI chat for product recommendations

UMODL1 Polyclonal antibody, PBS Only

UMODL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31666-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Olfactorin, uromodulin like 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

31666-1-PBS targets UMODL1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag36223

Product name: Recombinant human UMODL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 500-650 aa of BC167790

Sequence: RQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTRDATPSRAGRACEGDLVSPMGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPAAGQAWTPEPSPRRGGSNVVGYDRNNTGKGVEQELQGNSIMEPPSWPSPTE

Predict reactive species
Full Name uromodulin-like 1
Observed Molecular Weight136-157 kDa
GenBank Accession NumberBC167790
Gene Symbol UMODL1
Gene ID (NCBI) 89766
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ5DID0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

UMODL1(Uromodulin-like 1, uromodulin-like protein 1) is an important functional glycoprotein, belonging to the uromodulin (UMOD) gene family. Members of this family are usually expressed in kidney and urinary system, and play a role in the structure and function of extracellular matrix. Protein is located in extracellular matrix, and some studies have pointed out that UMODL1 can be used as one of the predictive markers of diabetes in multi-omics. It is involved in the process of fat development and the cell response to gonadotropin-releasing hormone (GnRH). It may also play a role in the development of ovarian follicles and participate in the migration of neutrophils. There are many isoforms, and the predicted molecular weight is 136-157 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...