UMPS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86260-4-RR (same clone as 86260-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86260-4-RR (UMPS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86260-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86260-4-RR

  Biolayer interferometry (BLl) kinetic assays of 86260-4-RR against Human UMPS were performed. The affinity constant is 2.31 nM.

UMPS Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86260-4-PBS

Clone No.251020B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ODC, OK/SW-cl.21, OMPD, OMPdecase, OPRT

---

Product Information

86260-4-PBS targets UMPS in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6620

  Product name: Recombinant human UMPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 189-480 aa of BC000364

  Sequence: VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

• Full Name: uridine monophosphate synthetase
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000364
• Gene Symbol: UMPS
• Gene ID (NCBI): 7372
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11172
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.