UMPS Recombinant monoclonal antibody

• 

  WB analysis using 86260-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86260-4-RR (UMPS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86260-4-RR

  Biolayer interferometry (BLl) kinetic assays of 86260-4-RR against Human UMPS were performed. The affinity constant is 2.31 nM.

UMPS Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86260-4-RR

Clone No.251020B9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ODC, OK/SW-cl.21, OMPD, OMPdecase, OPRT

---

Tested Applications

• Positive WB detected in: HeLa cells, COLO 320 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86260-4-RR targets UMPS in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6620

  Product name: Recombinant human UMPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 189-480 aa of BC000364

  Sequence: VDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

• Full Name: uridine monophosphate synthetase
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000364
• Gene Symbol: UMPS
• Gene ID (NCBI): 7372
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P11172
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.