UNK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UNK Polyclonal antibody, PBS Only (31574-1-PBS)

• 

  WB analysis using 31574-1-AP (same clone as 31574-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31574-1-AP (UNK antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31574-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 31574-1-AP (same clone as 31574-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using UNK antibody (31574-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31574-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 31574-1-AP (same clone as 31574-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using UNK antibody (31574-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31574-1-PBS in a different storage buffer formulation.

UNK Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31574-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ZC3HDC5, ZC3H5, unkempt homolog (Drosophila), KIAA1753

---

Product Information

31574-1-PBS targets UNK in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36222

  Product name: Recombinant human UNK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 640-810 aa of BC053362

  Sequence: SGPGAAELARLRQELDEANSTIKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERLHAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVLPCQHAALCELCAEGSECPICQPGRAHTLQS

• Full Name: unkempt homolog (Drosophila)
• Observed Molecular Weight: 88~100 kDa
• GenBank Accession Number: BC053362
• Gene Symbol: UNK
• Gene ID (NCBI): 85451
• RRID: AB_3670041
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9C0B0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Unkempt (UNK) is a sequence-specific RNA-binding protein which plays an important role in the establishment and maintenance of the early morphology of cortical neurons during embryonic development. UNK gene encodes a zinc finger/RING domain containing protein, as a negative regulator of the timing of photoreceptor differentiation.