UQCRC2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67547-1-Ig (same clone as 67547-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67547-1-Ig (UQCRC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67547-1-Ig (same clone as 67547-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67547-1-Ig (UQCRC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67547-1-Ig (same clone as 67547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67547-1-Ig (UQCRC2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67547-1-Ig (same clone as 67547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67547-1-Ig (UQCRC2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67547-1-Ig (same clone as 67547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67547-1-Ig (UQCRC2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67547-1-Ig (same clone as 67547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67547-1-Ig (UQCRC2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67547-1-Ig (same clone as 67547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67547-1-Ig (UQCRC2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67547-1-Ig (same clone as 67547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67547-1-Ig (UQCRC2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67547-1-PBS in a different storage buffer formulation.

UQCRC2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67547-1-PBS

Clone No.1A5G11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

1A5G11, Complex III subunit 2, Core protein II, Cytochrome b-c1 complex subunit 2, mitochondrial, QCR2

---

Product Information

67547-1-PBS targets UQCRC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6874

  Product name: Recombinant human UQCRC2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 103-453 aa of BC000484

  Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

• Full Name: ubiquinol-cytochrome c reductase core protein II
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000484
• Gene Symbol: UQCRC2
• Gene ID (NCBI): 7385
• RRID: AB_2882763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P22695
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.