Home
Products
Primary Antibodies
UQCRQ Polyclonal antibody, PBS Only (14975-1-PBS)

Filter: AllWBIPIHCIF/ICC

WB analysis using 14975-1-AP (same clone as 14975-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 14975-1-AP (UQCRQ antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
WB analysis of human liver using 14975-1-AP (same clone as 14975-1-PBS)
human liver tissue were subjected to SDS PAGE followed by western blot with 14975-1-AP (UQCRQ antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 14975-1-AP (same clone as 14975-1-PBS)
HepG2 cells were subjected to SDS PAGE followed by western blot with 14975-1-AP (UQCRQ antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
IP experiment of HepG2 using 14975-1-AP (same clone as 14975-1-PBS)
IP result of anti-UQCRQ (IP:14975-1-AP, 4ug; Detection:14975-1-AP 1:1000) with HepG2 cells lysate 3360 ug. This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 14975-1-AP (same clone as 14975-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14975-1-AP (UQCRQ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 14975-1-AP (same clone as 14975-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14975-1-AP (UQCRQ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 14975-1-AP (same clone as 14975-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14975-1-AP (UQCRQ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 14975-1-AP (same clone as 14975-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14975-1-AP (UQCRQ antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.
IF Staining of HepG2 using 14975-1-AP (same clone as 14975-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using UQCRQ antibody (14975-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14975-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

UQCRQ Polyclonal antibody, PBS Only

Name: UQCRQ Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 14975-1-PBS

UQCRQ Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14975-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

14975-1-PBS targets UQCRQ in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag6886 Product name: Recombinant human UQCRQ protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC001390 Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK Predict reactive species
Full Name	ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
Calculated Molecular Weight	10 kDa
Observed Molecular Weight	10 kDa
GenBank Accession Number	BC001390
Gene Symbol	UQCRQ
Gene ID (NCBI)	27089
RRID	AB_2288356
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O14949
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

UQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain. The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.