CoraLite® Plus 488-conjugated UQCRQ Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated UQCRQ Recombinant monoclonal antibody (CL488-87199)

UQCRQ Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-87199 Copied!

Clone No. 252364C10

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Complex III subunit 8, Complex III subunit VIII, Cytochrome b-c1 complex subunit 8, QCR8, QP C

• 

  IF Staining of HepG2 using CL488-87199

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 UQCRQ antibody (CL488-87199, Clone: 252364C10 ) at dilution of 1:200, CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UQCRQ in ?

Chat with Able

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-87199 targets UQCRQ in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6907

  Product name: Recombinant human UQCRQ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-82 aa of BC001390

  Sequence: MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

• Full Name: ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
• Calculated Molecular Weight: 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC001390
• Gene Symbol: UQCRQ
• Gene ID (NCBI): 27089
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14949
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

UQCRQ(Cytochrome b-c1 complex subunit 8) belongs to the UQCRQ/QCR8 family. UQCRQ is a ubiquinone-binding protein localized to the cytochrome bc1 region of the mitochondrial respiratory chain. The deduced 110-amino acid protein has a relatively hydrophobic and basic N-terminal region, an aspartic acid-rich middle region, and a glutamic acid- and lysine-rich C-terminal region.