URM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• URM1 Polyclonal antibody, PBS Only (15285-1-PBS)

• 

  WB analysis using 15285-1-AP (same clone as 15285-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 15285-1-AP (same clone as 15285-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15285-1-AP (same clone as 15285-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15285-1-AP (same clone as 15285-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 15285-1-AP (same clone as 15285-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 15285-1-AP (same clone as 15285-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 15285-1-AP (same clone as 15285-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 15285-1-AP (URM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 15285-1-AP (same clone as 15285-1-PBS)

  IP result of anti-URM1 (IP:15285-1-AP, 4ug; Detection:15285-1-AP 1:500) with HepG2 cells lysate 3360 ug. This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15285-1-AP (same clone as 15285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15285-1-AP (URM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15285-1-AP (same clone as 15285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15285-1-AP (URM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 15285-1-AP (same clone as 15285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 15285-1-AP (same clone as 15285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15285-1-AP (same clone as 15285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 15285-1-AP (same clone as 15285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 15285-1-AP (URM1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15285-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

URM1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15285-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15285-1-PBS targets URM1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7448

  Product name: Recombinant human URM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC003581

  Sequence: MAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG

• Full Name: ubiquitin related modifier 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC003581
• Gene Symbol: URM1
• Gene ID (NCBI): 81605
• RRID: AB_2213808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.