USP14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• USP14 Polyclonal antibody (14517-1-AP)

• Featured Product
• KD/KO Validated

USP14 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 14517-1-AP Copied!

Publications (45)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

Synonyms

Deubiquitinating enzyme 14, EC:3.4.19.12, TGT, Ubiquitin carboxyl-terminal hydrolase 14, Ubiquitin thioesterase 14

• 

  WB analysis using 14517-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14517-1-AP (USP14 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14517-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14517-1-AP (USP14 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14517-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14517-1-AP (USP14 antibody) at dilution of 1:9000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14517-1-AP

  WB result of USP14 antibody (14517-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP14 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 14517-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14517-1-AP (USP14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14517-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14517-1-AP (USP14 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 14517-1-AP

  IP result of anti-USP14 (IP:14517-1-AP, 4ug; Detection:14517-1-AP 1:1000) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14517-1-AP

  Immunofluorescent analysis of HepG2 cells, using USP14 antibody 14517-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for USP14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: DU 145 cells, HeLa cells, mouse heart tissue, HEK-293T cells, HEK-293 cells, SKOV-3 cells, Neuro-2a cells
• Positive IP detected in: mouse liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:18000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14517-1-AP targets USP14 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5979

  Product name: Recombinant human USP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-294 aa of BC003556

  Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL

• Full Name: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
• Calculated Molecular Weight: 54 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC003556
• Gene Symbol: USP14
• Gene ID (NCBI): 9097
• RRID: AB_2257124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54578
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress.This protein has a 45-kDa catalytic domain (PMID:16211010).

Publications

What published studies show

The USP14 Polyclonal antibody (catalog number 14517-1-AP) has 45 total citations. These appear in journals including Molecular Cancer, Autophagy, Science Advances, Cell Reports, Communications Biology, Journal of Biological Chemistry, Acta Pharmacologica Sinica, Free Radical Biology and Medicine, and Scientific Reports, among others. The associated research fields span cancer biology (colorectal, gastric, esophageal, breast, glioblastoma, and lung cancers), autophagy, ferroptosis, ubiquitination/deubiquitination, DNA damage repair, lipid metabolism, and neuroprotection, with applications primarily in Western blot, immunohistochemistry, and immunofluorescence.

Automatically generated from the 45 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cancer; NAP1L1 degradation by FBXW7 reduces the deubiquitination of HDGF-p62 signaling to stimulate autophagy and induce primary cisplatin chemosensitivity in nasopharyngeal carcinoma; Authors - Bin Gong
pig	WB,IP,IF	Autophagy; Inhibition of USP14 influences alphaherpesvirus proliferation by degrading viral VP16 protein via ER stress-triggered selective autophagy.; Authors - Sheng-Li Ming ; KD Validated
human	WB,IF	Autophagy; USP14 regulates DNA damage repair by targeting RNF168-dependent ubiquitination.; Authors - Arishya Sharma
		J Biomed Sci; USP9X-mediated REV1 deubiquitination promotes lung cancer radioresistance via the action of REV1 as a Rad18 molecular scaffold for cystathionine γ-lyase; Authors - Yunshang Chen
mouse	WB,IF,CoIP	Sci Adv; The cohesin-associated protein Pds5A governs the meiotic spindle assembly via deubiquitination of Kif5B in oocytes; Authors - Yu Zhang ; KD Validated
		Cell Mol Biol Lett; OTULIN protects hyperoxia-induced neonatal lung injury and modulates mitochondrial protein OPA1 in association with the E3 ubiquitin ligase RNF31.; Authors - Li Huang