• Featured Product
  • KD/KO Validated

CoraLite® Plus 555-conjugated USP14 Polyclonal antibody

USP14 Polyclonal Antibody for FC (Intra)
Cat No. CL555-14517

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

USP14, Deubiquitinating enzyme 14, EC:3.4.19.12, TGT, Ubiquitin carboxyl-terminal hydrolase 14, Ubiquitin thioesterase 14, Ubiquitin thiolesterase 14, Ubiquitin-specific-processing protease 14, USP 14

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells
Positive FC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-14517 targets USP14 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5979

Product name: Recombinant human USP14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-294 aa of BC003556

Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL

Predict reactive species
Full Name ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 52-60 kDa
GenBank Accession NumberBC003556
Gene Symbol USP14
Gene ID (NCBI) 9097
RRIDAB_2934638
Conjugate CoraLite® Plus 555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths554 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP54578
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

USP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress.This protein has a 45-kDa catalytic domain (PMID:16211010).

Protocols

Product Specific Protocols
FC protocol for CL Plus 555 USP14 antibody CL555-14517Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...