USP15 Monoclonal antibody, PBS Only

• 

  WB analysis using 67557-1-Ig (same clone as 67557-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67557-1-Ig (USP15 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67557-1-Ig (same clone as 67557-1-PBS)

  WB result of USP15 antibody (67557-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP15 transfected HeLa cells. This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67557-1-Ig (same clone as 67557-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67557-1-Ig (USP15 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67557-1-Ig (same clone as 67557-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67557-1-Ig (USP15 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67557-1-Ig (same clone as 67557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67557-1-Ig (USP15 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67557-1-Ig (same clone as 67557-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67557-1-Ig (USP15 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 67557-1-Ig (same clone as 67557-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using USP15 antibody (67557-1-Ig, Clone: 1C9G3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67557-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

USP15 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67557-1-PBS

Clone No.1C9G3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

1C9G3, Deubiquitinating enzyme 15, EC:3.4.19.12, KIAA0529, Ubiquitin carboxyl-terminal hydrolase 15

---

Product Information

67557-1-PBS targets USP15 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5712

  Product name: Recombinant human USP15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-235 aa of BC020688

  Sequence: MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKKPLEQSC

• Full Name: ubiquitin specific peptidase 15
• Calculated Molecular Weight: 112 kDa
• Observed Molecular Weight: 112 kDa
• GenBank Accession Number: BC020688
• Gene Symbol: USP15
• Gene ID (NCBI): 9958
• RRID: AB_2882771
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y4E8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitin is a highly conserved eukaryotic protein that is synthesized as a fusion protein precursor, either to itself or to one of two ribosomal proteins. USP15, is also named as KIAA0529,Unph-2, Unph4, encoding a human ubiquitin-specific protease (USP). The USP15 protein contains the highly conserved Cys and His boxes present in all members of he UBP family of deubiquitinating enzymes(PMID:10444327).It has 3 isoforms produced by alternative splicing.