USP19 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• USP19 Polyclonal antibody, PBS Only (25768-1-PBS)

• 

  WB analysis of Jurkat using 25768-1-AP (same clone as 25768-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25768-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25768-1-AP (same clone as 25768-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25768-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25768-1-AP (same clone as 25768-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25768-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25768-1-AP (same clone as 25768-1-PBS)

  WB result of USP19 antibody (25768-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-USP19 transfected HeLa cells. This data was developed using the same antibody clone with 25768-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25768-1-AP (same clone as 25768-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25768-1-AP (USP19 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25768-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 25768-1-AP (same clone as 25768-1-PBS)

  IP result of anti-USP19 (IP:25768-1-AP, 4ug; Detection:25768-1-AP 1:500) with Jurkat cells lysate 2400ug. This data was developed using the same antibody clone with 25768-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

USP19 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25768-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

EC:3.4.19.12, KIAA0891, Ubiquitin carboxyl-terminal hydrolase 19, Ubiquitin thioesterase 19, Ubiquitin-specific-processing protease 19

---

Product Information

25768-1-PBS targets USP19 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22646

  Product name: Recombinant human USP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 203-500 aa of BC146752

  Sequence: VEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGKDDCAKEEMAVAADAATLVDEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLEAPAARVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAVEKDKSKARSEDTGLDSVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPGFTGLV

• Full Name: ubiquitin specific peptidase 19
• Calculated Molecular Weight: 1318 aa, 146 kDa
• Observed Molecular Weight: 70 kDa, 120 kDa, 150-180 kDa
• GenBank Accession Number: BC146752
• Gene Symbol: USP19
• Gene ID (NCBI): 10869
• RRID: AB_2713918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94966
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitin-specific protease (USP)19 is a recently identified deubiquitinating enzyme (DUB) having multiple splice variants and cellular functions. Since the sum of molecular weights of the two small bands (65 kDa+120 kDa) approximates the size of the full-length protein (~185 kDa), USP19 is likely to be endoproteolytically cleaved. Interestingly, the small bands were not observed when the DUB activity was inactivated, suggesting that the cleavage of USP19 depends on its DUB activity (PMID: 25088257).