USP3 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• USP3 Recombinant monoclonal antibody, PBS Only (87122-1-PBS)

• 

  WB analysis using 87122-1-RR (same clone as 87122-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87122-1-RR (USP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87122-1-PBS in a different storage buffer formulation.

USP3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87122-1-PBS

Clone No.252249C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

EC:3.4.19.12, SIH003, Ubiquitin carboxyl-terminal hydrolase 3, Ubiquitin thioesterase 3, Ubiquitin-specific-processing protease 3

---

Product Information

87122-1-PBS targets USP3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14594

  Product name: Recombinant human USP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC018113

  Sequence: MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK

• Full Name: ubiquitin specific peptidase 3
• Calculated Molecular Weight: 520 aa, 59 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC018113
• Gene Symbol: USP3
• Gene ID (NCBI): 9960
• RRID: AB_3745354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y6I4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP3(Ubiquitin carboxyl-terminal hydrolase 3) belongs to the peptidase C19 family. It may regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. USP3 is implicated as a novel chromatin modifier in the maintenance of genome integrity. This protein has 2 isoforms produced by alternative splicing.