USP3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• USP3 Recombinant monoclonal antibody (87122-1-RR)

• 

  WB analysis using 87122-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87122-1-RR (USP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

USP3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87122-1-RR

Clone No.252249C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

EC:3.4.19.12, SIH003, Ubiquitin carboxyl-terminal hydrolase 3, Ubiquitin thioesterase 3, Ubiquitin-specific-processing protease 3

---

Tested Applications

• Positive WB detected in: K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87122-1-RR targets USP3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14594

  Product name: Recombinant human USP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC018113

  Sequence: MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENSTLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK

• Full Name: ubiquitin specific peptidase 3
• Calculated Molecular Weight: 520 aa, 59 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC018113
• Gene Symbol: USP3
• Gene ID (NCBI): 9960
• RRID: AB_3745354
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y6I4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

USP3(Ubiquitin carboxyl-terminal hydrolase 3) belongs to the peptidase C19 family. It may regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. USP3 is implicated as a novel chromatin modifier in the maintenance of genome integrity. This protein has 2 isoforms produced by alternative splicing.