USP4 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83734-2-RR (same clone as 83734-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83734-2-RR (USP4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83734-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 83734-2-RR (same clone as 83734-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83734-2-RR (USP4 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83734-2-PBS in a different storage buffer formulation.

• 

  FC experiment of U-251 using 83734-2-RR (same clone as 83734-2-PBS)

  1x10^6 U-251 cells were intracellularly stained with 0.25 ug USP4 Recombinant antibody (83734-2-RR, Clone:240797B11) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83734-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83734-2-RR (same clone as 83734-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug USP4 Recombinant antibody (83734-2-RR, Clone:240797B11) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83734-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00717-1

  Cytometric bead array standard curve of MP00717-1, USP4 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83734-2-PBS. Detection antibody: 83734-4-PBS. Standard: Ag28297. Range: 0.625-80 ng/mL.

• 

  Affinity and Kinetic Characterization of 83734-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83734-2-PBS against Human USP4 was performed. The affinity constant is 3.51 nM.

• 

  Affinity and Kinetic Characterization of 83734-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83734-2-RR against Human USP4 were performed. The affinity constant is 0.598 nM.

USP4 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83734-2-PBS

Clone No.240797B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

240797B11, EC:3.4.19.12, Ubiquitin carboxyl-terminal hydrolase 4, Ubiquitin-specific-processing protease 4, UNP

---

Product Information

83734-2-PBS targets USP4 as part of a matched antibody pair:

MP00717-1: 83734-2-PBS capture and 83734-4-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag28297

  Product name: Recombinant human USP4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 567-779 aa of BC125131

  Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR

• Full Name: ubiquitin specific peptidase 4 (proto-oncogene)
• Calculated Molecular Weight: 963 aa, 109 kDa
• Observed Molecular Weight: 109 kDa
• GenBank Accession Number: BC125131
• Gene Symbol: USP4
• Gene ID (NCBI): 7375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13107
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP4, also known as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341).