USP40 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• USP40 Polyclonal antibody, PBS Only (27217-1-PBS)

• 

  WB analysis using 27217-1-AP (same clone as 27217-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27217-1-AP (USP40 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27217-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 27217-1-AP (same clone as 27217-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 27217-1-AP (USP40 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27217-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 27217-1-AP (same clone as 27217-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 27217-1-AP (USP40 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27217-1-PBS in a different storage buffer formulation.

USP40 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27217-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

USP 40, Ubiquitin-specific-processing protease 40, Ubiquitin thioesterase 40, Ubiquitin carboxyl-terminal hydrolase 40, EC:3.4.19.12

---

Product Information

27217-1-PBS targets USP40 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25976

  Product name: Recombinant human USP40 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1161-1235 aa of BC013305

  Sequence: GDTIGVKNLLIDDDDDFSTIRDDTGKEKQKQRALGRRKSQEALHEQSSYILSSAETPARPRAPETSLSIHVGSFR

• Full Name: ubiquitin specific peptidase 40
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC013305
• Gene Symbol: USP40
• Gene ID (NCBI): 55230
• RRID: AB_3085938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

USP40 (ubiquitin specific peptidase 40), also known as ubiquitin thioesterase 40, deubiquitinating enzyme 40 or ubiquitin carboxyl-terminal hydrolase 40, is a 1235 amino acid protein that belongs to a large family of cysteine proteases that function as deubiquitinating enzymes. USP40 transcript is ubiquitously expressed but abundant in the kidney, heart, spleen, liver, and testis. Within the kidney, USP40 is expressed in glomerular endothelial cells during development (PMID:28148530).