CoraLite® Plus 488-conjugated USP8 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-83172-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 USP8 antibody (CL488-83172-2, Clone: 240016D3 ) at dilution of 1:200, CL594-Phalloidin (red).

USP8 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83172-2

Clone No.240016D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

240016D3, EC:3.4.19.12, hUBPy, HumORF8, KIAA0055

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83172-2 targets USP8 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27143

  Product name: Recombinant human USP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 15-253 aa of BC110590

  Sequence: SSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNV

• Full Name: ubiquitin specific peptidase 8
• Calculated Molecular Weight: 1118 aa, 128 kDa
• GenBank Accession Number: BC110590
• Gene Symbol: USP8
• Gene ID (NCBI): 9101
• RRID: AB_3673214
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40818
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

USP8 is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage.