UTRN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UTRN Polyclonal antibody, PBS Only (27948-1-PBS)

• 

  WB analysis using 27948-1-AP (same clone as 27948-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27948-1-AP (UTRN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27948-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27948-1-AP (same clone as 27948-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27948-1-AP (UTRN antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27948-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 27948-1-AP (same clone as 27948-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27948-1-AP (UTRN antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27948-1-PBS in a different storage buffer formulation.

UTRN Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27948-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27948-1-PBS targets UTRN in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27497

  Product name: Recombinant human UTRN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 711-932 aa of NM_007124

  Sequence: MQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHLENELKGQPGHAYLETLKTLKDVLNDSENKAQV

• Full Name: utrophin
• Calculated Molecular Weight: 395 kDa
• Observed Molecular Weight: 394 kDa, 70 kDa
• GenBank Accession Number: NM_007124
• Gene Symbol: UTRN
• Gene ID (NCBI): 7402
• RRID: AB_2881018
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46939
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Utrophin is a large protein (395 kDa) which is widely expressed and most abundant in several non-skeletal muscle tissues, for example lung, intestine, embryonic neural tube, sensory ganglia, tendons and ossifying cartilages. Two alternate intronic transcripts of utrophin have been described: Up71 and Up140.