UXT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• UXT Polyclonal antibody, PBS Only (11047-1-PBS)

• 

  WB analysis of HeLa using 11047-1-AP (same clone as 11047-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11047-1-AP (UXT antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11047-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 11047-1-AP (same clone as 11047-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11047-1-AP (UXT antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11047-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 11047-1-AP (same clone as 11047-1-PBS)

  IP result of anti-UXT (IP:11047-1-AP, 3ug; Detection:11047-1-AP 1:300) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 11047-1-PBS in a different storage buffer formulation.

UXT Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 11047-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

11047-1-PBS targets UXT in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1513

  Product name: Recombinant human UXT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-157 aa of BC008890

  Sequence: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH

• Full Name: ubiquitously-expressed transcript
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 18 kDa, 45 kDa
• GenBank Accession Number: BC008890
• Gene Symbol: UXT
• Gene ID (NCBI): 8409
• RRID: AB_2241535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBK9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ubiquitously expressed transcript (UXT) is a gene transcription regulator. It can regulate androgen receptor(AR) transcription by concerting with the coreperssor UR1. It is proposed a potential component of mitochondrial-associated LRPPRC, a multidomain organizer that potentially integrates mitochondria and the microtubular cytoskeleton with chromosome remodeling, for UXT increasing concentrations of UXT contributes to progressive aggregation of mitochondria and cell death potentially through its association with LRPPRC. UXT is possible a nuclear chaperone that promotes formation of the NF-kappa-B enhanceosome and which is essential for its nuclear function. It can suppresses cell transformation and mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like MECOM