Ubiquilin 1 Recombinant monoclonal antibody, PBS Only (Capture)

Ubiquilin 1 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84649-2-PBS
Clone No.242092E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

UBQLN1, 242092E9, DA41, DSK2, hPLIC 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84649-2-PBS targets Ubiquilin 1 as part of a matched antibody pair:

MP01462-1: 84649-2-PBS capture and 84649-1-PBS detection (validated in Cytometric bead array)

MP01462-2: 84649-2-PBS capture and 84649-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17530

Product name: Recombinant human Ubiquilin 1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 324-376 aa of BC010066

Sequence: WAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPG

Predict reactive species
Full Name ubiquilin 1
Calculated Molecular Weight 589 aa, 63 kDa
Observed Molecular Weight 63-71 kDa
GenBank Accession NumberBC010066
Gene Symbol Ubiquilin 1
Gene ID (NCBI) 29979
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UMX0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

UBQLN1, also known as DSK2 or Ubiquilin 1, is an ubiquitin-like proteinis contains a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.Ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. Higher levels of ubiquilin-1 in the brain decreased malformation of the APP molecule which plays a key role in triggering Alzheimers disease.Conversely, lower levels of ubiquilin-1 in the brain were associated with increased malformation of APP (PMID: 21852239). This antibody detects 70kD band of UBQLN1.

Loading...
||
New chat Able
正在加载,请稍候...