Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated Ubiquilin 1 Recombinant monoclonal antibody

Ubiquilin 1 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-84649-2
Clone No.242092E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

UBQLN1, 242092E9, DA41, DSK2, hPLIC 1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84649-2 targets Ubiquilin 1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17530

Product name: Recombinant human Ubiquilin 1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 324-376 aa of BC010066

Sequence: WAPQTSQSSSASSGTASTVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPG

Predict reactive species
Full Name ubiquilin 1
Calculated Molecular Weight 589 aa, 63 kDa
Observed Molecular Weight 63-71 kDa
GenBank Accession NumberBC010066
Gene Symbol Ubiquilin 1
Gene ID (NCBI) 29979
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UMX0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

UBQLN1, also known as DSK2 or Ubiquilin 1, is an ubiquitin-like proteinis contains a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.Ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer's and Parkinson's disease. Two transcript variants encoding different isoforms have been found for this gene. Higher levels of ubiquilin-1 in the brain decreased malformation of the APP molecule which plays a key role in triggering Alzheimers disease.Conversely, lower levels of ubiquilin-1 in the brain were associated with increased malformation of APP (PMID: 21852239). This antibody detects 70kD band of UBQLN1.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Ubiquilin 1 antibody CL488-84649-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...