Product Information
27303-1-PBS targets VAChT in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25153 Product name: Recombinant human SLC18A3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 410-501 aa of BC007765 Sequence: DVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLRE Predict reactive species |
| Full Name | solute carrier family 18 (vesicular acetylcholine), member 3 |
| Calculated Molecular Weight | 532 aa, 57 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC007765 |
| Gene Symbol | VAChT |
| Gene ID (NCBI) | 6572 |
| RRID | AB_3669592 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16572 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC18A3 also known as VAChT, is the vesicular amine transporter family member. The SLC18A3 gene encodes a transmembrane protein that transports acetylcholine (ACh) into presynaptic secretory vesicles for release at cholinergic nerve endings in the central and peripheral nervous systems. Mutations in SLC18A3 are associated with congenital myasthenic syndrome(PMID: 27590285). The 68-70 kDa mature glycosylated form of VAChT can be detected (PMID: 14705140).
