Product Information
13115-1-PBS targets VAMP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3787 Product name: Recombinant human VAMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC023286 Sequence: MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIM Predict reactive species |
| Full Name | vesicle-associated membrane protein 1 (synaptobrevin 1) |
| Calculated Molecular Weight | 117 aa, 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC023286 |
| Gene Symbol | VAMP1 |
| Gene ID (NCBI) | 6843 |
| RRID | AB_2214772 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23763 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
VAMP1, also named as synaptobrevin 1, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP1 is a part of the SNARE (soluble NSF-attachment protein receptor) complex. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP1 is involved in synaptic vesicle exocytosis, a fundamental step in neurotransmitter release.







