VAMP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• VAMP1 Polyclonal antibody, PBS Only (13115-1-PBS)

• 

  WB analysis of human brain using 13115-1-AP (same clone as 13115-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13115-1-AP (VAMP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13115-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13115-1-AP (same clone as 13115-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13115-1-AP (VAMP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13115-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13115-1-AP (same clone as 13115-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13115-1-AP (VAMP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13115-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 13115-1-AP (same clone as 13115-1-PBS)

  Immunofluorescent analysis of SH-SY5Y cells using 13115-1-AP (VAMP1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13115-1-PBS in a different storage buffer formulation.

VAMP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13115-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13115-1-PBS targets VAMP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3787

  Product name: Recombinant human VAMP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC023286

  Sequence: MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIM

• Full Name: vesicle-associated membrane protein 1 (synaptobrevin 1)
• Calculated Molecular Weight: 117 aa, 13 kDa
• Observed Molecular Weight: 13 kDa
• GenBank Accession Number: BC023286
• Gene Symbol: VAMP1
• Gene ID (NCBI): 6843
• RRID: AB_2214772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P23763
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

VAMP1, also named as synaptobrevin 1, is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. VAMP1 is a part of the SNARE (soluble NSF-attachment protein receptor) complex. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP1 is involved in synaptic vesicle exocytosis, a fundamental step in neurotransmitter release.